PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G25570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 209aa    MW: 22138.2 Da    PI: 9.8369
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G25570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.12.1e-25133178146
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskees 46 
                      +++pgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+s
  OPUNC02G25570.1 133 EPDPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVETS 178
                      699***************************************9975 PP

2QLQ52.31.7e-1866101237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      a+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  OPUNC02G25570.1  66 ALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 101
                      79*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-565101IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.7E-1166100IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.22566101IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.517133177IPR014977WRC domain
PfamPF088794.7E-21134176IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGEEKEADSP QPPSKLPRLS GADPNPGVVT MAAPPPVGLG LGLGLGGDSR GERDVEASAV  60
AHKATALTFM QQQELEHQVL IYRYFAAGAP VPVHLVLPIW KSVASSSFGP HRFPSLAVMG  120
LGNLCFDYRS SMEPDPGRCR RTDGKKWRCS RDVVPGHKYC ERHVHRGRGR SRKPVETSAA  180
ATPANNGGGG GIVFSPTSVL LAHGAARAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8347610.0CT834761.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA033I10, full insert sequence.
GenBankFJ5466940.0FJ546694.1 Oryza sativa Indica Group cultivar IR58 growth-regulating factor 10 (GRF10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647685.11e-126PREDICTED: growth-regulating factor 10
SwissprotQ6EPP91e-126GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A0E0K3L71e-152A0A0E0K3L7_ORYPU; Uncharacterized protein
STRINGORGLA02G0239200.11e-125(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.17e-37growth-regulating factor 3